PFDN1 (NM_002622) Human Recombinant Protein

CAT#: TP300584

Recombinant protein of human prefoldin subunit 1 (PFDN1)

Product Images

Coomassie blue staining of purified PFDN1 protein (Cat# TP300584). The protein was produced from HEK293T cells transfected with PFDN1 cDNA clone (Cat# RC200584) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200584 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFIL
  QSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002613
• Locus ID: 5201
• UniProt ID: O60925
• Cytogenetics: 5q31.3
• Refseq Size: 1324
• Refseq ORF: 366
• Synonyms: PDF; PFD1
• Summary: This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors