DDA1 (NM_024050) Human Recombinant Protein

CAT#: TP300826

Recombinant protein of human DET1 and DDB1 associated 1 (DDA1)

Product Images

Coomassie blue staining of purified DDA1 protein (Cat# TP300826). The protein was produced from HEK293T cells transfected with DDA1 cDNA clone (Cat# RC200826) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200826 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAK
  KRDQEQVELEGESSAPPRKVARTDSPDMHEDT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_076955
• Locus ID: 79016
• UniProt ID: Q9BW61, A0A024R7J7
• Cytogenetics: 19p13.11
• Refseq Size: 4078
• Refseq ORF: 306
• Synonyms: C19orf58; PCIA1
• Summary: May be involved in ubiquitination and subsequent proteasomal degradation of target proteins. Component of the DDD-E2 complexes which may provide a platform for interaction with CUL4A and WD repeat proteins.[UniProtKB/Swiss-Prot Function]