MOV10 (NM_020963) Human Recombinant Protein

CAT#: TP300934

Recombinant protein of human Mov10, Moloney leukemia virus 10, homolog (mouse) (MOV10), transcript variant 1

Product Images

Capture assay with wild-type (WT), C-terminal, and N-terminal of Mov10 (OriGene TP300934), and SuperScript III reverse transcriptase (SSRTIII) or bovine serum albumin (BSA) covalently coupled to beads indicates the binding of Mov10 N-terminal to SSRTIII. Figure cited from BMC Biol, PMID: 28662698

• 

  Representative gel images of the reverse transcriptase assay set up as shown in the table; SuperScript III reverse transcriptase (SSRTIII) was preincubated with the indicated concentrations of purified Mov10 (OriGene TP300934) or human purified recombinant Fmrp as a control, followed by RT-PCR of Prrc2b, L1 (mL1Tf), Gapdh RNAs bound by Mov10 or Fmrp. The addition of Mov10 blocked the reverse transcription of both L1 RNA and Prrc2b RNA; but only partially inhibited the reverse transcription of the Gapdh transcript, which is not bound by Mov10. Figure cited from BMC Biol, PMID: 28662698

• 

  Coomassie blue staining of purified MOV10 protein (Cat# TP300934). The protein was produced from HEK293T cells transfected with MOV10 cDNA clone (Cat# RC200934) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200934 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYGMKIANLAYVT
  KTRVRFFRLDRWADVRFPEKRRMKLGSDISKHHKSLLAKIFYDRAEYLHGKHGVDVEVQGPHEARDGQLL
  IRLDLNRKEVLTLRLRNGGTQSVTLTHLFPLCRTPQFAFYNEDQELPCPLGPGECYELHVHCKTSFVGYF
  PATVLWELLGPGESGSEGAGTFYIARFLAAVAHSPLAAQLKPMTPFKRTRITGNPVVTNRIEEGERPDRA
  KGYDLELSMALGTYYPPPRLRQLLPMLLQGTSIFTAPKEIAEIKAQLETALKWRNYEVKLRLLLHLEELQ
  MEHDIRHYDLESVPMTWDPVDQNPRLLTLEVPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKV
  ELDRVKLSFSMSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWLLWPMLFPVAPRDVPLLPSDVKL
  KLYDRSLESNPEQLQAMRHIVTGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGA
  DLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKPCCNWDAKKGEYVFPAKKKLQEYRVLITTLITAGRLV
  SAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMEVKETGDPGGQLVLAGDPRQLGPVLRSPLTQKHGLGY
  SLLERLLTYNSLYKKGPDGYDPQFITKLLRNYRSHPTILDIPNQLYYEGELQACADVVDRERFCRWAGLP
  RQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKI
  RYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVT
  RAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGYTGCPFPAKLDLQQGQNLLQGLSKLSPSTSGPHSHDY
  LPQEREGEGGLSLQVEPEWRNEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 113.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Binding assay (PMID: 28662698)
  In vitro reverse transcription assay (PMID: 28662698)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_066014
• Locus ID: 4343
• UniProt ID: Q9HCE1
• Cytogenetics: 1p13.2
• Refseq Size: 3767
• Refseq ORF: 3009
• Synonyms: fSAP113; gb110
• Summary: 5' to 3' RNA helicase contributing to UPF1 mRNA target degradation by translocation along 3' UTRs (PubMed:24726324). Required for microRNA (miRNA)-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC (PubMed:16289642, PubMed:17507929, PubMed:22791714). In cooperation with FMR1, regulates miRNA-mediated translational repression by AGO2 (PubMed:25464849). Restricts retrotransposition of long interspersed element-1 (LINE-1) in cooperation with TUT4 and TUT7 counteracting the RNA chaperonne activity of L1RE1 (PubMed:30122351, PubMed:23093941). Facilitates LINE-1 uridylation by TUT4 and TUT7 (PubMed:30122351). Required for embryonic viability and for normal central nervous system development and function. Plays two critical roles in early brain development: suppresses retroelements in the nucleus by directly inhibiting cDNA synthesis, while regulates cytoskeletal mRNAs to influence neurite outgrowth in the cytosol (By similarity). May function as a messenger ribonucleoprotein (mRNP) clearance factor (PubMed:24726324).[UniProtKB/Swiss-Prot Function]