PSMA7 (NM_002792) Human Recombinant Protein

CAT#: TP301169

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7)

Product Images

Coomassie blue staining of purified PSMA7 protein (Cat# TP301169). The protein was produced from HEK293T cells transfected with PSMA7 cDNA clone (Cat# RC201169) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201169 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC
  MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG
  TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV
  MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002783
• Locus ID: 5688
• UniProt ID: O14818, A0A0K0K1K4
• Cytogenetics: 20q13.33
• Refseq Size: 1050
• Refseq ORF: 744
• Synonyms: C6; HEL-S-276; HSPC; RC6-1; XAPC7
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. [provided by RefSeq, Jul 2012]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome