ATP6V1E1 (NM_001696) Human Recombinant Protein
CAT#: TP301267
Recombinant protein of human ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (ATP6V1E1), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201267 protein sequence
Red=Cloning site Green=Tags(s) MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKI QMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQD FPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPE VRGALFGANANRKFLD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001687 |
Locus ID | 529 |
UniProt ID | P36543, Q53Y06 |
Cytogenetics | 22q11.21 |
Refseq Size | 1406 |
Refseq ORF | 678 |
Synonyms | ARCL2C; ATP6E; ATP6E2; ATP6V1E; P31; Vma4 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq, Jul 2008] |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419796 | ATP6V1E1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422039 | ATP6V1E1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425635 | ATP6V1E1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419796 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (ATP6V1E1), transcript variant 1 |
USD 396.00 |
|
LY422039 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (ATP6V1E1), transcript variant 3 |
USD 396.00 |
|
LY425635 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (ATP6V1E1), transcript variant 3 |
USD 396.00 |
|
PH301267 | ATP6V1E1 MS Standard C13 and N15-labeled recombinant protein (NP_001687) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review