GADD45G (NM_006705) Human Recombinant Protein

CAT#: TP301364

Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G)

Product Images

Coomassie blue staining of purified GADD45G protein (Cat# TP301364). The protein was produced from HEK293T cells transfected with GADD45G cDNA clone (Cat# RC201364) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201364 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG
  DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL
  FCEESRSVNDWVPSITLPE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006696
• Locus ID: 10912
• UniProt ID: O95257
• Cytogenetics: 9q22.2
• Refseq Size: 1087
• Refseq ORF: 477
• Synonyms: CR6; DDIT2; GADD45gamma; GRP17
• Summary: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008]
• Protein Pathways: Cell cycle, MAPK signaling pathway, p53 signaling pathway