GADD45G (NM_006705) Human Recombinant Protein
CAT#: TP301364
Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G)
View other "GADD45G" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201364 protein sequence
Red=Cloning site Green=Tags(s) MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL FCEESRSVNDWVPSITLPE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006696 |
Locus ID | 10912 |
UniProt ID | O95257 |
Cytogenetics | 9q22.2 |
Refseq Size | 1087 |
Refseq ORF | 477 |
Synonyms | CR6; DDIT2; GADD45gamma; GRP17 |
Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008] |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416476 | GADD45G HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416476 | Transient overexpression lysate of growth arrest and DNA-damage-inducible, gamma (GADD45G) |
USD 396.00 |
|
PH301364 | GADD45G MS Standard C13 and N15-labeled recombinant protein (NP_006696) |
USD 2,055.00 |
|
TP720527 | Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review