TCTA (NM_022171) Human Recombinant Protein
CAT#: TP301387
Recombinant protein of human T-cell leukemia translocation altered gene (TCTA)
View other "TCTA" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201387 protein sequence
Red=Cloning site Green=Tags(s) MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHR PGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071503 |
Locus ID | 6988 |
UniProt ID | P57738 |
Cytogenetics | 3p21.31 |
Refseq Size | 2172 |
Refseq ORF | 309 |
Summary | May be required for cellular fusion during osteoclastogenesis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411726 | TCTA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411726 | Transient overexpression lysate of T-cell leukemia translocation altered gene (TCTA) |
USD 396.00 |
|
PH301387 | TCTA MS Standard C13 and N15-labeled recombinant protein (NP_071503) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review