CCM2 (NM_031443) Human Recombinant Protein
CAT#: TP301418
Recombinant protein of human cerebral cavernous malformation 2 (CCM2), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201418 protein sequence
Red=Cloning site Green=Tags(s) MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYL GQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIA AVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAAESKVAAEELC CLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGAS PHSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLL LGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE WDRMISDISSDIEALGCSMDQDSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_113631 |
Locus ID | 83605 |
UniProt ID | Q9BSQ5 |
Cytogenetics | 7p13 |
Refseq Size | 1904 |
Refseq ORF | 1332 |
Synonyms | C7orf22; OSM; PP10187 |
Summary | This gene encodes a scaffold protein that functions in the stress-activated p38 Mitogen-activated protein kinase (MAPK) signaling cascade. The protein interacts with SMAD specific E3 ubiquitin protein ligase 1 (also known as SMURF1) via a phosphotyrosine binding domain to promote RhoA degradation. The protein is required for normal cytoskeletal structure, cell-cell interactions, and lumen formation in endothelial cells. Mutations in this gene result in cerebral cavernous malformations. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410516 | CCM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422467 | CCM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC425504 | CCM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432927 | CCM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432976 | CCM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410516 | Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 2 |
USD 325.00 |
|
LY422467 | Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 1 |
USD 495.00 |
|
LY425504 | Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 1 |
USD 325.00 |
|
LY432927 | Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 4 |
USD 325.00 |
|
LY432976 | Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 3 |
USD 325.00 |
|
PH301418 | CCM2 MS Standard C13 and N15-labeled recombinant protein (NP_113631) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review