ILKAP (NM_030768) Human Recombinant Protein

CAT#: TP301456

Recombinant protein of human integrin-linked kinase-associated serine/threonine phosphatase 2C (ILKAP)


  View other "ILKAP" proteins (3)

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

USD 439.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit polyclonal anti-ILKAP antibody
    • 100 ul

USD 345.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "ILKAP"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201456 protein sequence
Red=Cloning site Green=Tags(s)

MDLFGDLPEPERSPRPAAGKEAQKGPLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMV
KTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITEECRPPSS
LITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQK
PAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRD
GRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKI
QTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.7 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_110395
Locus ID 80895
UniProt ID Q9H0C8
Cytogenetics 2q37.3
Refseq Size 1480
Refseq ORF 1176
Synonyms ILKAP2; ILKAP3; PP2C-DELTA; PP2CD; PPM1O
Summary The protein encoded by this gene is a protein serine/threonine phosphatase of the PP2C family. This protein can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, this protein may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in Wnt signaling pathway. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Phosphatase

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.