ACAD8 (NM_014384) Human Recombinant Protein
CAT#: TP301507
Recombinant protein of human acyl-Coenzyme A dehydrogenase family, member 8 (ACAD8)
View other "ACAD8" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201507 protein sequence
Red=Cloning site Green=Tags(s) MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQK ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEE QRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGL GPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINI ASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVAL CSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055199 |
Locus ID | 27034 |
UniProt ID | Q9UKU7 |
Cytogenetics | 11q25 |
Refseq Size | 2216 |
Refseq ORF | 1245 |
Synonyms | ACAD-8; ARC42; IBDH |
Summary | This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.[provided by RefSeq, Nov 2009] |
Protein Families | Transcription Factors |
Protein Pathways | Metabolic pathways, Valine, leucine and isoleucine degradation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415328 | ACAD8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415328 | Transient overexpression lysate of acyl-Coenzyme A dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein |
USD 396.00 |
|
PH301507 | ACAD8 MS Standard C13 and N15-labeled recombinant protein (NP_055199) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review