GATA3 (NM_002051) Human Recombinant Protein
CAT#: TP301618
Recombinant protein of human GATA binding protein 3 (GATA3), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201618 protein sequence
Red=Cloning site Green=Tags(s) MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP TPMHPPSSLSFGPHHPSSMVTAMG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | GATA3 Activity Verified in a DNA-binding Assay: DNA binding activity of GATA3 as a function of protein concentration. Sensitivity to competitor oligonucleotide demonstrates specificity of protein-DNA binding. EMSA assay (PMID: 26216189) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002042 |
Locus ID | 2625 |
UniProt ID | P23771 |
Cytogenetics | 10p14 |
Refseq Size | 3067 |
Refseq ORF | 1332 |
Synonyms | HDR; HDRS |
Summary | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009] |
Protein Families | Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400759 | GATA3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424146 | GATA3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400759 | Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 2 |
USD 396.00 |
|
LY424146 | Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 1 |
USD 605.00 |
|
PH301618 | GATA3 MS Standard C13 and N15-labeled recombinant protein (NP_002042) |
USD 2,055.00 |
|
TP761574 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review