CIRBP (NM_001280) Human Recombinant Protein

CAT#: TP301639

Recombinant protein of human cold inducible RNA binding protein (CIRBP), transcript variant 1

Product Images

Coomassie blue staining of purified CIRBP protein (Cat# TP301639). The protein was produced from HEK293T cells transfected with CIRBP cDNA clone (Cat# RC201639) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201639 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGK
  SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD
  YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001271
• Locus ID: 1153
• UniProt ID: Q14011, Q53XX5
• Cytogenetics: 19p13.3
• Refseq Size: 1397
• Refseq ORF: 516
• Synonyms: CIRP
• Summary: Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3' UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.[UniProtKB/Swiss-Prot Function]