PDIA6 (NM_005742) Human Recombinant Protein
CAT#: TP301710
Recombinant protein of human protein disulfide isomerase family A, member 6 (PDIA6)
View other "PDIA6" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201710 protein sequence
Red=Cloning site Green=Tags(s) MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAAT ALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLG GRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ TKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLE IINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALG IGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP VEDDIDLSDVELDDLGKDEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005733 |
Locus ID | 10130 |
UniProt ID | Q15084, A0A384NPU5 |
Cytogenetics | 2p25.1 |
Refseq Size | 2349 |
Refseq ORF | 1320 |
Synonyms | ERP5; P5; TXNDC7 |
Summary | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, a TRX-like domain, and a C-terminal ER-retention sequence. This protein inhibits the aggregation of misfolded proteins and exhibits both isomerase and chaperone activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401760 | PDIA6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401760 | Transient overexpression lysate of protein disulfide isomerase family A, member 6 (PDIA6) |
USD 396.00 |
|
PH301710 | PDIA6 MS Standard C13 and N15-labeled recombinant protein (NP_005733) |
USD 2,055.00 |
|
TP720679 | Purified recombinant protein of Human protein disulfide isomerase family A, member 6 (PDIA6) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review