RGS19 (NM_001039467) Human Recombinant Protein

CAT#: TP301715

Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 2

Product Images

Coomassie blue staining of purified RGS19 protein (Cat# TP301715). The protein was produced from HEK293T cells transfected with RGS19 cDNA clone (Cat# RC201715) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201715 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPL
  PSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR
  LIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGP
  SQSSSEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034556
• Locus ID: 10287
• UniProt ID: P49795
• Cytogenetics: 20q13.33
• Refseq Size: 1493
• Refseq ORF: 651
• Synonyms: GAIP; RGSGAIP
• Summary: G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome