RGS19 (NM_005873) Human Mass Spec Standard

CAT#: PH309082

RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_005864)

Product Images

Coomassie blue staining of purified RGS19 protein (Cat# TP309082). The protein was produced from HEK293T cells transfected with RGS19 cDNA clone (Cat# RC209082) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209082
• Predicted MW: 24.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209082 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPL
  PSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR
  LIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGP
  SQSSSEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005864
• RefSeq Size: 1593
• RefSeq ORF: 651
• Synonyms: GAIP; RGSGAIP
• Locus ID: 10287
• UniProt ID: P49795
• Cytogenetics: 20q13.33
• Summary: G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome