HADHSC (HADH) (NM_005327) Human Recombinant Protein

CAT#: TP301752

Recombinant protein of human hydroxyacyl-Coenzyme A dehydrogenase (HADH), nuclear gene encoding mitochondrial protein


  View other "HADH" proteins (5)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


HADH mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
    • 100 ul

USD 379.00

Other products for "HADH"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201752 protein sequence
Red=Cloning site Green=Tags(s)

MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGI
EESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAE
HTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVS
CKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEM
DAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.8 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_005318
Locus ID 3033
UniProt ID Q16836, A0A140VK76
Cytogenetics 4q25
Refseq Size 1986
Refseq ORF 942
Synonyms HAD; HADH1; HADHSC; HCDH; HHF4; MSCHAD; SCHAD
Summary This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15. [provided by RefSeq, May 2010]
Protein Pathways Butanoate metabolism, Fatty acid elongation in mitochondria, Fatty acid metabolism, Lysine degradation, Metabolic pathways, Tryptophan metabolism, Valine, leucine and isoleucine degradation

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.