UBE2N (NM_003348) Human Recombinant Protein
CAT#: TP301792
Recombinant protein of human ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N)
View other "UBE2N" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201792 protein sequence
Red=Cloning site Green=Tags(s) MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA RAWTRLYAMNNI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003339 |
Locus ID | 7334 |
UniProt ID | P61088, V9HW41 |
Cytogenetics | 12q22 |
Refseq Size | 2568 |
Refseq ORF | 456 |
Synonyms | HEL-S-71; UBC13; UbcH-ben; UbcH13; UBCHBEN |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418741 | UBE2N HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418741 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N) |
USD 396.00 |
|
PH301792 | UBE2N MS Standard C13 and N15-labeled recombinant protein (NP_003339) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review