UBE2N (NM_003348) Human Recombinant Protein

CAT#: TP301792

Recombinant protein of human ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N)

Product Images

Coomassie blue staining of purified UBE2N protein (Cat# TP301792). The protein was produced from HEK293T cells transfected with UBE2N cDNA clone (Cat# RC201792) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201792 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR
  FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA
  RAWTRLYAMNNI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003339
• Locus ID: 7334
• UniProt ID: P61088, V9HW41
• Cytogenetics: 12q22
• Refseq Size: 2568
• Refseq ORF: 456
• Synonyms: HEL-S-71; UBC13; UbcH-ben; UbcH13; UBCHBEN
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis