TPD52 (NM_005079) Human Recombinant Protein
CAT#: TP301956
Recombinant protein of human tumor protein D52 (TPD52), transcript variant 3
View other "TPD52" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201956 protein sequence
Red=Cloning site Green=Tags(s) MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRK LGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEK VENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005070 |
Locus ID | 7163 |
UniProt ID | P55327 |
Cytogenetics | 8q21.13 |
Refseq Size | 4031 |
Refseq ORF | 552 |
Synonyms | D52; hD52; N8L; PC-1; PrLZ |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417563 | TPD52 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417563 | Transient overexpression lysate of tumor protein D52 (TPD52), transcript variant 3 |
USD 396.00 |
|
PH301956 | TPD52 MS Standard C13 and N15-labeled recombinant protein (NP_005070) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review