TFPI (NM_001032281) Human Recombinant Protein
CAT#: TP302098
Recombinant protein of human tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) (TFPI), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202098 protein sequence
Red=Cloning site Green=Tags(s) MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRF FFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITR YFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFV TKEGTNDGWKNAAHIYQVFLNAFCIHASMFFLGLDSISCLC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001027452 |
Locus ID | 7035 |
UniProt ID | P10646 |
Cytogenetics | 2q32.1 |
Refseq Size | 1166 |
Refseq ORF | 753 |
Synonyms | EPI; LACI; TFI; TFPI1 |
Summary | This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. [provided by RefSeq, Jul 2016] |
Protein Families | Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401895 | TFPI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422293 | TFPI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401895 | Transient overexpression lysate of tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) (TFPI), transcript variant 1 |
USD 325.00 |
|
LY422293 | Transient overexpression lysate of tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) (TFPI), transcript variant 2 |
USD 325.00 |
|
PH302098 | TFPI MS Standard C13 and N15-labeled recombinant protein (NP_001027452) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review