VAT1 (NM_006373) Human Recombinant Protein
CAT#: TP302201
Recombinant protein of human vesicle amine transport protein 1 homolog (T. californica) (VAT1)
View other "VAT1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202201 protein sequence
Red=Cloning site Green=Tags(s) MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYDKVKLQSRPAA PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNRS GMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVHMAAGGVGMAAVQLCR TVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMG KVVTYGMANLLTGPKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYN QGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKEN SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 41.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006364 |
Locus ID | 10493 |
UniProt ID | Q99536, A0A024R1Z6 |
Cytogenetics | 17q21.31 |
Refseq Size | 2758 |
Refseq ORF | 1179 |
Synonyms | VATI |
Summary | Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401915 | VAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401915 | Transient overexpression lysate of vesicle amine transport protein 1 homolog (T. californica) (VAT1) |
USD 396.00 |
|
PH302201 | VAT1 MS Standard C13 and N15-labeled recombinant protein (NP_006364) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review