Gemin 6 (GEMIN6) (NM_024775) Human Recombinant Protein
CAT#: TP302296
Recombinant protein of human gem (nuclear organelle) associated protein 6 (GEMIN6)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202296 protein sequence
Red=Cloning site Green=Tags(s) MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYD PENCSSSNEIILSRVQDLIEGHLTASQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079051 |
Locus ID | 79833 |
UniProt ID | Q8WXD5 |
Cytogenetics | 2p22.1 |
Refseq Size | 705 |
Refseq ORF | 501 |
Summary | GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM, Jul 2002] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411066 | GEMIN6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411066 | Transient overexpression lysate of gem (nuclear organelle) associated protein 6 (GEMIN6) |
USD 325.00 |
|
PH302296 | GEMIN6 MS Standard C13 and N15-labeled recombinant protein (NP_079051) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review