Gemin 6 (GEMIN6) (NM_024775) Human Recombinant Protein

CAT#: TP302296

Recombinant protein of human gem (nuclear organelle) associated protein 6 (GEMIN6)

Product Images

Coomassie blue staining of purified GEMIN6 protein (Cat# TP302296). The protein was produced from HEK293T cells transfected with GEMIN6 cDNA clone (Cat# RC202296) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202296 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET
  MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYD
  PENCSSSNEIILSRVQDLIEGHLTASQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079051
• Locus ID: 79833
• UniProt ID: Q8WXD5
• Cytogenetics: 2p22.1
• Refseq Size: 705
• Refseq ORF: 501
• Summary: GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM, Jul 2002]
• Protein Families: Druggable Genome, Stem cell - Pluripotency