RGS16 (NM_002928) Human Recombinant Protein

CAT#: TP302430

Recombinant protein of human regulator of G-protein signaling 16 (RGS16)

Product Images

Coomassie blue staining of purified RGS16 protein (Cat# TP302430). The protein was produced from HEK293T cells transfected with RGS16 cDNA clone (Cat# RC202430) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202430 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLL
  SSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELT
  RMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002919
• Locus ID: 6004
• UniProt ID: O15492
• Cytogenetics: 1q25.3
• Refseq Size: 2432
• Refseq ORF: 606
• Synonyms: A28-RGS14; A28-RGS14P; RGS-R
• Summary: The protein encoded by this gene belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome