Carboxypeptidase B2 (CPB2) (NM_001872) Human Recombinant Protein
CAT#: TP302800
Recombinant protein of human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202800 protein sequence
Red=Cloning site Green=Tags(s) MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHF FVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERH PDMLTKIHIGSSFEKYPLYVLKVSGKEQAAKNAIWIDCGIHAREWISPAFCLWFIGHITQFYGIIGQYTN LLRLVDFYVMPVVNVDGYDYSWKKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCG LYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKTSKN TRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVI RNV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001863 |
Locus ID | 1361 |
UniProt ID | Q96IY4 |
Cytogenetics | 13q14.13 |
Refseq Size | 1766 |
Refseq ORF | 1269 |
Synonyms | CPU; PCPB; TAFI |
Summary | Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). The protein encoded by this gene is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis. Polymorphisms have been described for this gene and its promoter region. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414007 | CPB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC419700 | CPB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY414007 | Transient overexpression lysate of carboxypeptidase B2 (plasma) (CPB2), transcript variant 2 |
USD 325.00 |
|
LY419700 | Transient overexpression lysate of carboxypeptidase B2 (plasma) (CPB2), transcript variant 1 |
USD 325.00 |
|
PH302800 | CPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001863) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review