ABI3 (NM_016428) Human Recombinant Protein
CAT#: TP302853
Recombinant protein of human ABI family, member 3 (ABI3), transcript variant 1
View other "ABI3" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202853 protein sequence
Red=Cloning site Green=Tags(s) MAELQQLQEFEIPTGREALRGNHSALLRVADYCEDNYVQATDKRKALEETMAFTTQALASVAYQVGNLAG HTLRMLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRP LNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASATLGRPPRIPEPVHLPVVPDGRLSAASSASS LASAGSAEGVGGAPTPKGQAAPPAPPLPSSLDPPPPPAAVEVFQRPPTLEELSPPPPDEELPLPLDLPPP PPLDGDELGLPPPPPGFGPDEPSWVPASYLEKVVTLYPYTSQKDNELSFSEGTVICVTRRYSDGWCEGVS SEGTGFFPGNYVEPSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057512 |
Locus ID | 51225 |
UniProt ID | Q9P2A4 |
Cytogenetics | 17q21.32 |
Refseq Size | 2129 |
Refseq ORF | 1098 |
Synonyms | NESH; SSH3BP3 |
Summary | This gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain, and are components of the Abi/WAVE complex which regulates actin polymerization. The encoded protein inhibits ectopic metastasis of tumor cells as well as cell migration. This may be accomplished through interaction with p21-activated kinase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414015 | ABI3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414015 | Transient overexpression lysate of ABI family, member 3 (ABI3), transcript variant 1 |
USD 396.00 |
|
PH302853 | ABI3 MS Standard C13 and N15-labeled recombinant protein (NP_057512) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review