RRAD (NM_004165) Human Recombinant Protein

CAT#: TP302927

Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 2

Product Images

Coomassie blue staining of purified RRAD protein (Cat# TP302927). The protein was produced from HEK293T cells transfected with RRAD cDNA clone (Cat# RC202927) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202927 representing NM_004165
  Red=Cloning site Green=Tags(s)
  
  MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL
  DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL
  MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS
  REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR
  FLGRIVARNSRKMAFRAKSKSCHDLSVL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004156
• Locus ID: 6236
• UniProt ID: P55042, A0A024R6X0
• Cytogenetics: 16q22.1
• Refseq Size: 1443
• Refseq ORF: 924
• Synonyms: RAD; RAD1; REM3
• Summary: May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.[UniProtKB/Swiss-Prot Function]