RRAD (NM_004165) Human Mass Spec Standard

CAT#: PH302927

RRAD MS Standard C13 and N15-labeled recombinant protein (NP_004156)

Product Images

Coomassie blue staining of purified RRAD protein (Cat# TP302927). The protein was produced from HEK293T cells transfected with RRAD cDNA clone (Cat# RC202927) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202927
• Predicted MW: 33.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202927 representing NM_004165
  Red=Cloning site Green=Tags(s)
  
  MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL
  DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL
  MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS
  REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR
  FLGRIVARNSRKMAFRAKSKSCHDLSVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004156
• RefSeq Size: 1443
• RefSeq ORF: 924
• Synonyms: RAD; RAD1; REM3
• Locus ID: 6236
• UniProt ID: P55042, A0A024R6X0
• Cytogenetics: 16q22.1
• Summary: ''