CHCHD6 (NM_032343) Human Recombinant Protein

CAT#: TP302975

Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6)

Product Images

Coomassie blue staining of purified CHCHD6 protein (Cat# TP302975). The protein was produced from HEK293T cells transfected with CHCHD6 cDNA clone (Cat# RC202975) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202975 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNLRAPHKESTLP
  RSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARE
  LESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTIKPRRVEPVCSGLQAQILHCYRD
  RPHEVLLCSDLVKAYQRCVSAAHKG
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 26.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115719
• Locus ID: 84303
• UniProt ID: Q9BRQ6
• Cytogenetics: 3q21.3
• Refseq Size: 1020
• Refseq ORF: 705
• Synonyms: CHCM1; Mic25; MICOS25; PPP1R23
• Summary: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.[UniProtKB/Swiss-Prot Function]