HSD17B2 (NM_002153) Human Recombinant Protein

CAT#: TP303293

Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 2 (HSD17B2)

Product Images

HSD17B2 enzymatic activity with 75μM β-estradiol as a substrate, measured by NADH production (indicated by luminescence).

• 

  Coomassie blue staining of purified HSD17B2 protein (Cat# TP303293). The protein was produced from HEK293T cells transfected with HSD17B2 cDNA clone (Cat# RC203293) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203293 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT
  YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT
  KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS
  KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE
  KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL
  AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002144
• Locus ID: 3294
• UniProt ID: P37059
• Cytogenetics: 16q23.3
• Refseq Size: 1451
• Refseq ORF: 1161
• Synonyms: EDH17B2; HSD17; SDR9C2
• Summary: Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, Metabolic pathways