Lin28 (LIN28A) (NM_024674) Human Recombinant Protein
CAT#: TP303397
Purified recombinant protein of Homo sapiens lin-28 homolog (LIN28)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203397 protein sequence
Red=Cloning site Green=Tags(s) MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPV DVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCY NCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078950 |
Locus ID | 79727 |
UniProt ID | Q9H9Z2 |
Cytogenetics | 1p36.11 |
Refseq Size | 4014 |
Refseq ORF | 627 |
Synonyms | CSDD1; LIN-28; lin-28A; LIN28; ZCCHC1 |
Summary | This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues. [provided by RefSeq, Sep 2015] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411135 | LIN28A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411135 | Transient overexpression lysate of lin-28 homolog (LIN28) |
USD 325.00 |
|
PH303397 | LIN28A MS Standard C13 and N15-labeled recombinant protein (NP_078950) |
USD 2,055.00 |
|
TP723273 | Purified recombinant protein of Human lin-28 homolog A (LIN28A). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review