Lin28 (LIN28A) (NM_024674) Human Recombinant Protein
CAT#: TP723273
Purified recombinant protein of Human lin-28 homolog A (LIN28A).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
GPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGP
|
Tag | 13-residue TAT |
Predicted MW | 24.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >90% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Measured by its ability to induce fluorescence in Lin28 reporter cells (293 cells transfected with fluorescent protein genes under Lin28 control). Optimum activity was achieved at 20 ug/mL after incubation for 72 hr. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_078950 |
Locus ID | 79727 |
UniProt ID | Q9H9Z2 |
Cytogenetics | 1p36.11 |
Refseq Size | 4014 |
Refseq ORF | 627 |
Synonyms | CSDD1; LIN-28; lin-28A; LIN28; ZCCHC1 |
Summary | This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues. [provided by RefSeq, Sep 2015] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411135 | LIN28A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411135 | Transient overexpression lysate of lin-28 homolog (LIN28) |
USD 325.00 |
|
PH303397 | LIN28A MS Standard C13 and N15-labeled recombinant protein (NP_078950) |
USD 2,055.00 |
|
TP303397 | Purified recombinant protein of Homo sapiens lin-28 homolog (LIN28) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review