D4 (ARHGDIB) (NM_001175) Human Recombinant Protein

CAT#: TP303496

Recombinant protein of human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB)

Product Images

Coomassie blue staining of purified ARHGDIB protein (Cat# TP303496). The protein was produced from HEK293T cells transfected with ARHGDIB cDNA clone (Cat# RC203496) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203496 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT
  RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT
  FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001166
• Locus ID: 397
• UniProt ID: P52566, A0A024RAS5
• Cytogenetics: 12p12.3
• Refseq Size: 1216
• Refseq ORF: 603
• Synonyms: D4; GDIA2; GDID4; Ly-GDI; LYGDI; RAP1GN1; RhoGDI2
• Summary: Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Neurotrophin signaling pathway