SH3BP5 (NM_004844) Human Recombinant Protein

CAT#: TP303999

Recombinant protein of human SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 1

Product Images

Coomassie blue staining of purified SH3BP5 protein (Cat# TP303999). The protein was produced from HEK293T cells transfected with SH3BP5 cDNA clone (Cat# RC203999) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203999 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDAALKRSRSEEPAEILPPARDEEEEEEEGMEQGLEEEEEVDPRIQGELEKLNQSTDDINRRETELEDAR
  QKFRSVLVEATVKLDELVKKIGKAVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAE
  QRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKP
  YFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSST
  SVEDLPGSKPEPDAISVASEAFEDDSCSNFVSEDDSETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLP
  SPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRGLSSSSGSGGSSKSQSST
  SPEGQALENRMKQLSLQCSKGRDGIIADIKMVQIG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004835
• Locus ID: 9467
• UniProt ID: O60239
• Cytogenetics: 3p25.1
• Refseq Size: 3322
• Refseq ORF: 1365
• Synonyms: SAB; SH3BP-5
• Summary: Functions as guanine nucleotide exchange factor (GEF) with specificity for RAB11A and RAB25 (PubMed:26506309, PubMed:30217979). Inhibits the auto- and transphosphorylation activity of BTK. Plays a negative regulatory role in BTK-related cytoplasmic signaling in B-cells. May be involved in BCR-induced apoptotic cell death.[UniProtKB/Swiss-Prot Function]