Ribonuclease H2, subunit A (RNASEH2A) (NM_006397) Human Recombinant Protein

CAT#: TP304032

Recombinant protein of human ribonuclease H2, subunit A (RNASEH2A)

Product Images

Coomassie blue staining of purified RNASEH2A protein (Cat# TP304032). The protein was produced from HEK293T cells transfected with RNASEH2A cDNA clone (Cat# RC204032) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204032 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKT
  LLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFV
  DTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGY
  PNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQAR
  PRSSHRYFLERGLESATSL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006388
• Locus ID: 10535
• UniProt ID: O75792
• Cytogenetics: 19p13.13
• Refseq Size: 1148
• Refseq ORF: 897
• Synonyms: AGS4; JUNB; RNASEHI; RNHIA; RNHL; THSD8
• Summary: The protein encoded by this gene is a component of the heterotrimeric type II ribonuclease H enzyme (RNAseH2). RNAseH2 is the major source of ribonuclease H activity in mammalian cells and endonucleolytically cleaves ribonucleotides. It is predicted to remove Okazaki fragment RNA primers during lagging strand DNA synthesis and to excise single ribonucleotides from DNA-DNA duplexes. Mutations in this gene cause Aicardi-Goutieres Syndrome (AGS), a an autosomal recessive neurological disorder characterized by progressive microcephaly and psychomotor retardation, intracranial calcifications, elevated levels of interferon-alpha and white blood cells in the cerebrospinal fluid.[provided by RefSeq, Aug 2009]
• Protein Pathways: DNA replication