TIGAR (NM_020375) Human Recombinant Protein
CAT#: TP304087
Recombinant protein of human chromosome 12 open reading frame 5 (C12orf5)
View other "TIGAR" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204087 protein sequence
Red=Cloning site Green=Tags(s) MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGIL ERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLC QLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFL TDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065108 |
Locus ID | 57103 |
UniProt ID | Q9NQ88 |
Cytogenetics | 12p13.32 |
Refseq Size | 8237 |
Refseq ORF | 810 |
Synonyms | C12orf5; FR2BP |
Summary | This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412517 | C12orf5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412517 | Transient overexpression lysate of chromosome 12 open reading frame 5 (C12orf5) |
USD 396.00 |
|
PH304087 | C12orf5 MS Standard C13 and N15-labeled recombinant protein (NP_065108) |
USD 2,055.00 |
|
TP723445 | Purified recombinant protein of Human chromosome 12 open reading frame 5 (C12orf5). |
USD 240.00 |
|
TP723446 | Purified recombinant protein of Human chromosome 12 open reading frame 5 (C12orf5). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review