DDX3 (DDX3X) (NM_001356) Human Recombinant Protein

CAT#: TP304171

Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked (DDX3X)

Product Images

DDX5 interacts with Nullbasic in vitro, as measured by the Octet Red system. Biotinylated recombinant Nullbasic-FLAG-V5-6-His was bound to a streptavidin biosensor and applied to solutions containing 3.3, 10, 30 or 90 nM of human recombinant Myc-DDK-tagged DDX5 (OriGene TP304171). BSA served as a control. Figure cited from Retrovirology, PMID: 25496916

• 

  Coomassie blue staining of purified DDX3X protein (Cat# TP304171). The protein was produced from HEK293T cells transfected with DDX3X cDNA clone (Cat# RC204171) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204171 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYS
  SFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPL
  PPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHA
  IPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAV
  QIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD
  RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
  WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSG
  KSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLL
  VEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGS
  SRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 73.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Biolayer interferometry (BLI) assay (PMID: 25496916)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001347
• Locus ID: 1654
• UniProt ID: O00571
• Cytogenetics: Xp11.4
• Refseq Size: 5433
• Refseq ORF: 1986
• Synonyms: CAP-Rf; DBX; DDX3; DDX14; HLP2; MRX102; MRXSSB
• Summary: The protein encoded by this gene is a member of the large DEAD-box protein family, that is defined by the presence of the conserved Asp-Glu-Ala-Asp (DEAD) motif, and has ATP-dependent RNA helicase activity. This protein has been reported to display a high level of RNA-independent ATPase activity, and unlike most DEAD-box helicases, the ATPase activity is thought to be stimulated by both RNA and DNA. This protein has multiple conserved domains and is thought to play roles in both the nucleus and cytoplasm. Nuclear roles include transcriptional regulation, mRNP assembly, pre-mRNA splicing, and mRNA export. In the cytoplasm, this protein is thought to be involved in translation, cellular signaling, and viral replication. Misregulation of this gene has been implicated in tumorigenesis. This gene has a paralog located in the nonrecombining region of the Y chromosome. Pseudogenes sharing similarity to both this gene and the DDX3Y paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
• Protein Families: ES Cell Differentiation/IPS
• Protein Pathways: RIG-I-like receptor signaling pathway