NIP30 (FAM192A) (NM_024946) Human Recombinant Protein

CAT#: TP304378

Recombinant protein of human NEFA-interacting nuclear protein NIP30 (NIP30)

Product Images

Coomassie blue staining of purified FAM192A protein (Cat# TP304378). The protein was produced from HEK293T cells transfected with FAM192A cDNA clone (Cat# RC204378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYE
  EQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKP
  IETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIG
  ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Enzyme substrate (PMID: 29804834)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079222
• Locus ID: 80011
• UniProt ID: Q9GZU8, A0A024R6T8
• Cytogenetics: 16q13
• Refseq Size: 2865
• Refseq ORF: 762
• Synonyms: C16orf94; CDA018; CDA10; FAM192A; NIP30; PIP30
• Summary: Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the catalytic chamber of the proteasome. Also inhibits the interaction of PSME3 with COIL, inhibits accumulation of PSME3 in Cajal bodies and positively regulates the number of Cajal bodies in the nucleus.[UniProtKB/Swiss-Prot Function]