NIP30 (FAM192A) (NM_024946) Human Mass Spec Standard

CAT#: PH304378

FAM192A MS Standard C13 and N15-labeled recombinant protein (NP_079222)

Product Images

Coomassie blue staining of purified FAM192A protein (Cat# TP304378). The protein was produced from HEK293T cells transfected with FAM192A cDNA clone (Cat# RC204378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204378
• Predicted MW: 28.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYE
  EQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKP
  IETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIG
  ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079222
• RefSeq Size: 2865
• RefSeq ORF: 762
• Synonyms: C16orf94; CDA018; CDA10; NIP30; PIP30
• Locus ID: 80011
• UniProt ID: Q9GZU8, A0A024R6T8
• Cytogenetics: 16q13