RAB3IL1 (NM_013401) Human Recombinant Protein

CAT#: TP304592

Recombinant protein of human RAB3A interacting protein (rabin3)-like 1 (RAB3IL1)

Product Images

Coomassie blue staining of purified RAB3IL1 protein (Cat# TP304592). The protein was produced from HEK293T cells transfected with RAB3IL1 cDNA clone (Cat# RC204592) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204592 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQGQEGPAAAQLDVLRLRSSSME
  IREKGSEFLKEELHRAQKELKLKDEECERLSKVREQLEQELEELTASLFEEAHKMVREANMKQAASEKQL
  KEARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHKSTSSTLCPAVCPAAGHT
  LTPDREGKEVDTILFAEFQAWRESPTLDKTCPFLERVYREDVGPCLDFTMQELSVLVRAAVEDNTLTIEP
  VASQTLPTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQG
  LVRQDAEPMFWEIMRLRKEMSLAKLGFFPQEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037533
• Locus ID: 5866
• UniProt ID: Q8TBN0
• Cytogenetics: 11q12.2-q12.3
• Refseq Size: 2392
• Refseq ORF: 1146
• Synonyms: GRAB
• Summary: This gene encodes a guanine nucleotide exchange factor for the ras-related protein Rab3A. The encoded protein binds Rab3a and the inositol hexakisphosphate kinase InsP6K1. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Nov 2012]