Arginase 1 (ARG1) (NM_000045) Human Recombinant Protein

CAT#: TP304649

Recombinant protein of human arginase, liver (ARG1), 20 µg


  View other "Arginase 1" proteins (4)

USD 737.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
    • 100 ul

USD 447.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 519.00

Other products for "Arginase 1"

Specifications

Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
>RC204649 protein sequence
Red=Cloning site Green=Tags(s)

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNP
RSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNL
HGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK
VMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP
SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Arginase activity verified in a biochemical assay: Arginase 1 (ARG1, TP304649) activity was measured in a colorimetric biochemical assay. Arginase 1 catalyzes the conversion of arginine to ornithine and urea. After incubation of the protein in a solution containing L-arginine, the reaction is stopped, and the urea concentration is measured by a chemical reaction that produces a colored product that absorbs at 430 nm. By measuring the absorbance at 430 nm and comparing to a standard, the specific activity of this preparation of ARG1 was calculated to be approximately 10U/mg.
Unit definition: 1 unit of ARG1 converts 1 µmole of L-arginine to ornithine and urea per minute at pH 9.5 and 37ºC.
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_000036
Locus ID 383
UniProt ID P05089
Cytogenetics 6q23.2
Refseq Size 1475
Refseq ORF 966
Summary Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Protein Families Druggable Genome
Protein Pathways Arginine and proline metabolism, Metabolic pathways

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.