Arginase 1 (ARG1) (NM_000045) Human Recombinant Protein
CAT#: TP721013
Purified recombinant protein of Human arginase, liver (ARG1)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYR
|
Tag | C-His |
Predicted MW | 35.8 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, 20% Glycerol, pH7.5 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000036 |
Locus ID | 383 |
UniProt ID | P05089 |
Cytogenetics | 6q23.2 |
Refseq Size | 1475 |
Refseq ORF | 966 |
Summary | 'Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]' |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424951 | ARG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424951 | Transient overexpression lysate of arginase, liver (ARG1) |
USD 325.00 |
|
PH304649 | ARG1 MS Standard C13 and N15-labeled recombinant protein (NP_000036) |
USD 2,055.00 |
|
TP304649 | Recombinant protein of human arginase, liver (ARG1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review