PPP1R1C (NM_001080545) Human Recombinant Protein
CAT#: TP305047
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205047 protein sequence
Red=Cloning site Green=Tags(s) MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001074014 |
Locus ID | 151242 |
UniProt ID | Q8WVI7 |
Cytogenetics | 2q31.3-q32.1 |
Refseq Size | 1078 |
Refseq ORF | 327 |
Synonyms | IPP5 |
Summary | Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421099 | PPP1R1C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY421099 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C) |
USD 396.00 |
|
PH305047 | PPP1R1C MS Standard C13 and N15-labeled recombinant protein (NP_001074014) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review