PPP1R1C (NM_001080545) Human Recombinant Protein

CAT#: TP305047

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)

Product Images

Coomassie blue staining of purified PPP1R1C protein (Cat# TP305047). The protein was produced from HEK293T cells transfected with PPP1R1C cDNA clone (Cat# RC205047) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205047 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK
  QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001074014
• Locus ID: 151242
• UniProt ID: Q8WVI7
• Cytogenetics: 2q31.3-q32.1
• Refseq Size: 1078
• Refseq ORF: 327
• Synonyms: IPP5
• Summary: Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010]
• Protein Families: Druggable Genome, Phosphatase