Peroxiredoxin 1 (PRDX1) (NM_181697) Human Recombinant Protein
CAT#: TP305072
Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205072 protein sequence
Red=Cloning site Green=Tags(s) MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_859048 |
Locus ID | 5052 |
UniProt ID | Q06830, A0A384NPQ2 |
Cytogenetics | 1p34.1 |
Refseq Size | 1043 |
Refseq ORF | 597 |
Synonyms | MSP23; NKEF-A; NKEFA; PAG; PAGA; PAGB; PRX1; PRXI; TDPX2 |
Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jan 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403646 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405338 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419239 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430560 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403646 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 2 |
USD 396.00 |
|
LY405338 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 3 |
USD 396.00 |
|
LY419239 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 1 |
USD 396.00 |
|
LY430560 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 3 |
USD 396.00 |
|
PH305072 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859048) |
USD 2,055.00 |
|
PH321235 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_002565) |
USD 2,055.00 |
|
PH322186 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859047) |
USD 2,055.00 |
|
TP321235 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 1 |
USD 748.00 |
|
TP322186 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 2 |
USD 748.00 |
|
TP721190 | Purified recombinant protein of Human peroxiredoxin 1 (PRDX1), transcript variant 3 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review