Peroxiredoxin 1 (PRDX1) (NM_181697) Human Recombinant Protein
CAT#: TP721190
Purified recombinant protein of Human peroxiredoxin 1 (PRDX1), transcript variant 3
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGSSHHHHHHSSGLVPRGSHMSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQKLEHHHHHH*
|
Tag | N, C-His |
Predicted MW | 25.3 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS, 10% glycerol, 0.1mM DTT,pH 6.0. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_859048 |
Locus ID | 5052 |
UniProt ID | Q06830, A0A384NPQ2 |
Cytogenetics | 1p34.1 |
Refseq Size | 1043 |
Refseq ORF | 597 |
Synonyms | MSP23; NKEF-A; NKEFA; PAG; PAGA; PAGB; PRX1; PRXI; TDPX2 |
Summary | 'This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jan 2011]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403646 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC405338 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC419239 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430560 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403646 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 2 |
USD 325.00 |
|
LY405338 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 3 |
USD 325.00 |
|
LY419239 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 1 |
USD 325.00 |
|
LY430560 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 3 |
USD 325.00 |
|
PH305072 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859048) |
USD 2,055.00 |
|
PH321235 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_002565) |
USD 2,055.00 |
|
PH322186 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859047) |
USD 2,055.00 |
|
TP305072 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 3 |
USD 823.00 |
|
TP321235 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 1 |
USD 748.00 |
|
TP322186 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review