MIF (NM_002415) Human Recombinant Protein
CAT#: TP305106
Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205106 protein sequence
Red=Cloning site Green=Tags(s) MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.3 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002406 |
| Locus ID | 4282 |
| UniProt ID | P14174, I4AY87 |
| Cytogenetics | 22q11.23 |
| Refseq Size | 561 |
| Refseq ORF | 345 |
| Synonyms | GIF; GLIF; MMIF |
| Summary | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Phenylalanine metabolism, Tyrosine metabolism |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400864 | MIF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400864 | Transient overexpression lysate of macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
USD 436.00 |
|
| PH305106 | MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406) |
USD 2,055.00 |
|
| TP721165 | Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
USD 330.00 |
|
| TP723300 | Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China