MIF (NM_002415) Human Recombinant Protein
CAT#: TP723300
Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | Hi-5 insect |
Expression cDNA Clone or AA Sequence |
HHHHHHHHAMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
Tag | N-His |
Predicted MW | 15 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to inhibit monocyte migration. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002406 |
Locus ID | 4282 |
UniProt ID | P14174, I4AY87 |
Cytogenetics | 22q11.23 |
Refseq Size | 561 |
Refseq ORF | 345 |
Synonyms | GIF; GLIF; MMIF |
Summary | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Phenylalanine metabolism, Tyrosine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400864 | MIF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400864 | Transient overexpression lysate of macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
USD 325.00 |
|
PH305106 | MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406) |
USD 2,055.00 |
|
TP305106 | Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
USD 823.00 |
|
TP721165 | Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review