PTS (NM_000317) Human Recombinant Protein
CAT#: TP305199
Recombinant protein of human 6-pyruvoyltetrahydropterin synthase (PTS)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205199 protein sequence
Red=Cloning site Green=Tags(s) MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMV MNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYMWDNLQKVLPVGVLYKVKVYETDNNIV VYKGE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000308 |
Locus ID | 5805 |
UniProt ID | Q03393 |
Cytogenetics | 11q23.1 |
Refseq Size | 948 |
Refseq ORF | 435 |
Synonyms | PTPS |
Summary | The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400120 | PTS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400120 | Transient overexpression lysate of 6-pyruvoyltetrahydropterin synthase (PTS) |
USD 396.00 |
|
PH305199 | PTS MS Standard C13 and N15-labeled recombinant protein (NP_000308) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review