Calponin (CNN1) (NM_001299) Human Recombinant Protein

CAT#: TP305370

Recombinant protein of human calponin 1, basic, smooth muscle (CNN1)

Product Images

Coomassie blue staining of purified CNN1 protein (Cat# TP305370). The protein was produced from HEK293T cells transfected with CNN1 cDNA clone (Cat# RC205370) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205370 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG
  SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV
  GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT
  NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE
  LGEPAHNHHAHNYYNSA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001290
• Locus ID: 1264
• UniProt ID: P51911, V9HWA5
• Cytogenetics: 19p13.2
• Refseq Size: 1599
• Refseq ORF: 891
• Synonyms: HEL-S-14; Sm-Calp; SMCC
• Summary: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]