RAB18 (NM_021252) Human Recombinant Protein
CAT#: TP305505
Recombinant protein of human RAB18, member RAS oncogene family (RAB18)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205505 protein sequence
Red=Cloning site Green=Tags(s) MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERF RTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFA RKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067075 |
Locus ID | 22931 |
UniProt ID | Q9NP72 |
Cytogenetics | 10p12.1 |
Refseq Size | 5003 |
Refseq ORF | 618 |
Synonyms | RAB18LI1; WARBM3 |
Summary | The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402861 | RAB18 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402861 | Transient overexpression lysate of RAB18, member RAS oncogene family (RAB18) |
USD 396.00 |
|
PH305505 | RAB18 MS Standard C13 and N15-labeled recombinant protein (NP_067075) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review