ASRGL1 (NM_025080) Human Recombinant Protein
CAT#: TP305645
Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205645 representing NM_025080
Red=Cloning site Green=Tags(s) MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLN TNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLV TERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYAD NDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTS TSMPWAAAKDGKLHFGIDPDDTTITDLP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079356 |
Locus ID | 80150 |
UniProt ID | Q7L266, A0A024R573 |
Cytogenetics | 11q12.3 |
Refseq Size | 1332 |
Refseq ORF | 924 |
Synonyms | ALP; ALP1; CRASH |
Summary | Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.[UniProtKB/Swiss-Prot Function] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410905 | ASRGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421255 | ASRGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410905 | Transient overexpression lysate of asparaginase like 1 (ASRGL1), transcript variant 2 |
USD 325.00 |
|
LY421255 | Transient overexpression lysate of asparaginase like 1 (ASRGL1), transcript variant 1 |
USD 325.00 |
|
PH305645 | ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_079356) |
USD 2,055.00 |
|
PH314638 | ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_001077395) |
USD 2,055.00 |
|
TP314638 | Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review