LSM7 (NM_016199) Human Recombinant Protein
CAT#: TP305835
Recombinant protein of human LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM7)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205835 protein sequence
Red=Cloning site Green=Tags(s) MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQ LGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057283 |
Locus ID | 51690 |
UniProt ID | Q9UK45 |
Cytogenetics | 19p13.3 |
Refseq Size | 536 |
Refseq ORF | 309 |
Synonyms | YNL147W |
Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation, Spliceosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414131 | LSM7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414131 | Transient overexpression lysate of LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM7) |
USD 396.00 |
|
PH305835 | LSM7 MS Standard C13 and N15-labeled recombinant protein (NP_057283) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review